(data stored in SCRATCH zone)

EMBL: CP002417.PE301

CP002417.PE301       Location/Qualifiers
FT   CDS             complement(319075..320034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0302"
FT                   /product="beta-lactamase domain protein"
FT                   /note="KEGG: vap:Vapar_0292 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34524"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E6V293"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0292"
FT                   /protein_id="ADU34524.1"
FT                   /translation="MSQAKKFASQADMEEKKITFSQISEHAWAYTAEGDPNTGIVIGDD
FT                   CVLVADTQATPAMAADVVRRIREVTDKPIKYVVLTHYHAVRVLGAAGYGAEHILASQDT
FT                   RDLIVERGEADKASEIGRFPRLFQNVETVPPGLTWPTMTFAGKMTLWLGKLEVQLIQLG
FT                   RGHTKGDTVVWLPGEKTLLSGDLVEFGATPYAGDAYFQDWPQTLDNIAALQPAALVPGR
FT                   GAALTTPAEVAEGLTGTRNFISDVYASVQEGVKAGRDLNTVYKDTYAKLKPKYSQWVIF
FT                   DHCMPFDVSRAYDEASGHADPRVWTAERDIEMWKALEG"
     MSQAKKFASQ ADMEEKKITF SQISEHAWAY TAEGDPNTGI VIGDDCVLVA DTQATPAMAA        60
     DVVRRIREVT DKPIKYVVLT HYHAVRVLGA AGYGAEHILA SQDTRDLIVE RGEADKASEI       120
     GRFPRLFQNV ETVPPGLTWP TMTFAGKMTL WLGKLEVQLI QLGRGHTKGD TVVWLPGEKT       180
     LLSGDLVEFG ATPYAGDAYF QDWPQTLDNI AALQPAALVP GRGAALTTPA EVAEGLTGTR       240
     NFISDVYASV QEGVKAGRDL NTVYKDTYAK LKPKYSQWVI FDHCMPFDVS RAYDEASGHA       300
     DPRVWTAERD IEMWKALEG                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page