(data stored in ACNUC1104 zone)

EMBL: CP002417.PE303

CP002417.PE303       Location/Qualifiers
FT   CDS             321085..321840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0304"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: vap:Vapar_0294 silent information regulator protein
FT                   Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34526"
FT                   /db_xref="GOA:E6V295"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:E6V295"
FT                   /inference="protein motif:PFAM:PF02146"
FT                   /protein_id="ADU34526.1"
FT                   /translation="MTRPDATDTTSISSPLAAAIALLRDARRIVVFSGAGLSRASGIPT
FT                   YRDADGLWKSQNALQFSHAEDLKRDPAGFTKFWGQRMSVVESATPNPGHRALAQLQRLR
FT                   PATRLVTQNVDGLLTQAGGLDVLELHGSLRRWRCDHCGNRSGPWPFHRCLRCGSHARPD
FT                   VVMFGEMLNPGVLLEAQVAAQESDLFMVVGSTTIVYPAAELPELAMARGSRLITLNLEP
FT                   LPHLDDSAAVVLRGTSEDLLPRLLAGLGG"
     MTRPDATDTT SISSPLAAAI ALLRDARRIV VFSGAGLSRA SGIPTYRDAD GLWKSQNALQ        60
     FSHAEDLKRD PAGFTKFWGQ RMSVVESATP NPGHRALAQL QRLRPATRLV TQNVDGLLTQ       120
     AGGLDVLELH GSLRRWRCDH CGNRSGPWPF HRCLRCGSHA RPDVVMFGEM LNPGVLLEAQ       180
     VAAQESDLFM VVGSTTIVYP AAELPELAMA RGSRLITLNL EPLPHLDDSA AVVLRGTSED       240
     LLPRLLAGLG G                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page