(data stored in ACNUC1104 zone)

EMBL: CP002417.PE306

CP002417.PE306       Location/Qualifiers
FT   CDS             complement(322815..323489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0307"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   vap:Vapar_0296 protein of unknown function DUF330"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34529"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:E6V298"
FT                   /inference="protein motif:PFAM:PF03886"
FT                   /protein_id="ADU34529.1"
FT                   /translation="MKTTTHPLASALAGLGIALLVAGCGALPDKPARAKLYDFGPGVSA
FT                   MATAPAAAASPALPMLALAEIEANTRLDGTQILYRLGYADTNELRPYGQSRWSQPPAQL
FT                   LRQRLRDSLAERRTVLGPEESATLARSKGEVPDTLRISLDEFSHYFDSPASSAGLVRLR
FT                   ATLIRGGTGGDRVLGQKTFTVRRPAPSADAPGGVKALAAASDAAVAEVTQWMDALQRQP
FT                   RQ"
     MKTTTHPLAS ALAGLGIALL VAGCGALPDK PARAKLYDFG PGVSAMATAP AAAASPALPM        60
     LALAEIEANT RLDGTQILYR LGYADTNELR PYGQSRWSQP PAQLLRQRLR DSLAERRTVL       120
     GPEESATLAR SKGEVPDTLR ISLDEFSHYF DSPASSAGLV RLRATLIRGG TGGDRVLGQK       180
     TFTVRRPAPS ADAPGGVKAL AAASDAAVAE VTQWMDALQR QPRQ                        224
//

If you have problems or comments...

PBIL Back to PBIL home page