(data stored in ACNUC1104 zone)

EMBL: CP002417.PE31

CP002417.PE31        Location/Qualifiers
FT   CDS             complement(34834..35235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0031"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cu(I)-responsive transcriptional regulator;
FT                   PFAM: Transcription regulator MerR DNA binding; regulatory
FT                   protein MerR; KEGG: vap:Vapar_0029 transcriptional
FT                   regulator, MerR family; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34254"
FT                   /db_xref="GOA:E6UXR0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR0"
FT                   /inference="protein motif:TFAM:TIGR02044"
FT                   /protein_id="ADU34254.1"
FT                   /translation="MTVQVAIGEAARLSGVSARMVRHYEGLGLLPAVARTDSGYRQYSE
FT                   ADVHTLRFIKRSRDLGFSMEEIAELVGLWHNRRRASSSVKRVAEKHLGELEQRIADMQS
FT                   MRNTLAHLVHCCHGDARPDCPILDDLGKA"
     MTVQVAIGEA ARLSGVSARM VRHYEGLGLL PAVARTDSGY RQYSEADVHT LRFIKRSRDL        60
     GFSMEEIAEL VGLWHNRRRA SSSVKRVAEK HLGELEQRIA DMQSMRNTLA HLVHCCHGDA       120
     RPDCPILDDL GKA                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page