(data stored in ACNUC1104 zone)

EMBL: CP002417.PE310

CP002417.PE310       Location/Qualifiers
FT   CDS             complement(326627..327541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0311"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0300 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34533"
FT                   /db_xref="GOA:E6V2A2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2A2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34533.1"
FT                   /translation="MTTAAMDLQILRAFVLAAKEGNVSRAAERLHLTQPAVSLQLKRFA
FT                   EETGLVLFTRTPHGLALTADGAAMLPQAERVLAAVGDLQQAARKLQGTVRGALRIGTIL
FT                   DPEFTRLGVFLRELVEAAPQIETELRHGMSGSVLAQVLRGDLDVGFHLDPGDDDQAATT
FT                   PAPALSVRPLTRFTYRVVAPAGWGPQVQGRDWKALAALPWLATPPESAHHRLLERVFAP
FT                   LGLSPRRVAMVDQEASMLDLLKSGIGLSLVRDSIAIRECQAHGLAMADRVQLDCALRFV
FT                   SLASRRDEPVIASAWDALAKAWN"
     MTTAAMDLQI LRAFVLAAKE GNVSRAAERL HLTQPAVSLQ LKRFAEETGL VLFTRTPHGL        60
     ALTADGAAML PQAERVLAAV GDLQQAARKL QGTVRGALRI GTILDPEFTR LGVFLRELVE       120
     AAPQIETELR HGMSGSVLAQ VLRGDLDVGF HLDPGDDDQA ATTPAPALSV RPLTRFTYRV       180
     VAPAGWGPQV QGRDWKALAA LPWLATPPES AHHRLLERVF APLGLSPRRV AMVDQEASML       240
     DLLKSGIGLS LVRDSIAIRE CQAHGLAMAD RVQLDCALRF VSLASRRDEP VIASAWDALA       300
     KAWN                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page