(data stored in SCRATCH zone)

EMBL: CP002417.PE312

CP002417.PE312       Location/Qualifiers
FT   CDS             329174..329782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0313"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cai:Caci_5383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34535"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2A4"
FT                   /inference="similar to AA sequence:KEGG:Caci_5383"
FT                   /protein_id="ADU34535.1"
FT                   /translation="MQESGWQPIAGRVGHVGGIESFTLDGRHHYFGFDHKRGLVLSPAI
FT                   DDAAAMAHFASRHMQAIYRGRLFGLLGKTGPRDEAFWAEAVEWSENATDLPGQPERALA
FT                   SAQLAASVSKLGLAAQENRIAREFIPDALPCMLLAAAGDGSPDEAEGIQAEVAIVWGRE
FT                   PLPPGREIADVARALQARLNALVDRAQGNWAQIFSMLKS"
     MQESGWQPIA GRVGHVGGIE SFTLDGRHHY FGFDHKRGLV LSPAIDDAAA MAHFASRHMQ        60
     AIYRGRLFGL LGKTGPRDEA FWAEAVEWSE NATDLPGQPE RALASAQLAA SVSKLGLAAQ       120
     ENRIAREFIP DALPCMLLAA AGDGSPDEAE GIQAEVAIVW GREPLPPGRE IADVARALQA       180
     RLNALVDRAQ GNWAQIFSML KS                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page