(data stored in SCRATCH zone)

EMBL: CP002417.PE317

CP002417.PE317       Location/Qualifiers
FT   CDS             complement(335132..335437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0318"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34540"
FT                   /db_xref="GOA:E6V2A9"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2A9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0305"
FT                   /protein_id="ADU34540.1"
FT                   /translation="MASTASHALLHRVAETGRAAVAFTLDGEPASALAGDTVLTAVLTQ
FT                   AGQLRRNEFSDMPRAGFCMMGACQDCWIATAEGERLRACSTFIAPGMALVTGRSGA"
     MASTASHALL HRVAETGRAA VAFTLDGEPA SALAGDTVLT AVLTQAGQLR RNEFSDMPRA        60
     GFCMMGACQD CWIATAEGER LRACSTFIAP GMALVTGRSG A                           101
//

If you have problems or comments...

PBIL Back to PBIL home page