(data stored in ACNUC1104 zone)

EMBL: CP002417.PE319

CP002417.PE319       Location/Qualifiers
FT   CDS             complement(336237..337097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0320"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0307
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34542"
FT                   /db_xref="GOA:E6V2B1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34542.1"
FT                   /translation="MSGIRNKAAPWWLSGPALLLFTALLLVPLLLTAVLSFNVYDPATG
FT                   PKAGEFTLAHYAHVFTDSYYHGIFWRTFWISALVTLICVVIGAPEAYVLSRMRNPWRSI
FT                   LLLVVLAPLLVSVVVRAFGWSMLLGPEGAVNSLLGLVGIGPVKMLYTEIAVIVALVHVM
FT                   LPFMVIPVWTSLQKLDAGVENAALSLKASPFTTLRRIVLPQVMPGILSGSLIVFGLAAS
FT                   SFAIPGLLGGRRLKMVATVVYDEYLSELNWPLGAAIALTLLAANLIVMLSYNRLVEGRY
FT                   KKALG"
     MSGIRNKAAP WWLSGPALLL FTALLLVPLL LTAVLSFNVY DPATGPKAGE FTLAHYAHVF        60
     TDSYYHGIFW RTFWISALVT LICVVIGAPE AYVLSRMRNP WRSILLLVVL APLLVSVVVR       120
     AFGWSMLLGP EGAVNSLLGL VGIGPVKMLY TEIAVIVALV HVMLPFMVIP VWTSLQKLDA       180
     GVENAALSLK ASPFTTLRRI VLPQVMPGIL SGSLIVFGLA ASSFAIPGLL GGRRLKMVAT       240
     VVYDEYLSEL NWPLGAAIAL TLLAANLIVM LSYNRLVEGR YKKALG                      286
//

If you have problems or comments...

PBIL Back to PBIL home page