(data stored in ACNUC1104 zone)

EMBL: CP002417.PE32

CP002417.PE32        Location/Qualifiers
FT   CDS             complement(35232..35426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0032"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: vap:Vapar_0030 heavy metal transport/detoxification
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34255"
FT                   /db_xref="GOA:E6UXR1"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR1"
FT                   /inference="protein motif:PFAM:PF00403"
FT                   /protein_id="ADU34255.1"
FT                   /translation="MSQKFQVSGMSCGHCVNAVQNAVQTVDPEAQVTVDLETGHVDVLS
FT                   EQPRKDIVAAIENAGYAVQ"
     MSQKFQVSGM SCGHCVNAVQ NAVQTVDPEA QVTVDLETGH VDVLSEQPRK DIVAAIENAG        60
     YAVQ                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page