(data stored in ACNUC1104 zone)

EMBL: CP002417.PE321

CP002417.PE321       Location/Qualifiers
FT   CDS             338371..339249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0322"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: vap:Vapar_0309 transcriptional regulator, IclR
FT                   family; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34544"
FT                   /db_xref="GOA:E6V2B3"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B3"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADU34544.1"
FT                   /translation="MESNSEAAAASPASSGGVPRVFSVIRALGAVQAEGGRVTQIARSV
FT                   GLTQATTHRLLQSLMAEGMVEQDERSKLYRLSIDFFALAASAGNPGDLRSICRPVLLRL
FT                   CASLGDSIFLLARSGFDAICLDRSEGPFPIRSFTGDIGGRIALGVGQGALAILAFLPEA
FT                   EREEVIRFNLSRVREYGVYDEVYLRTEIERVRQQGYAGRNTGLLEGMAGVAVPILDREG
FT                   RAVAALSVGTIADRLNADRMPTVVELLKREAAAIGPKINPFDATLRRPAQSLAGSPGGQ
FT                   KIALPEAPGPG"
     MESNSEAAAA SPASSGGVPR VFSVIRALGA VQAEGGRVTQ IARSVGLTQA TTHRLLQSLM        60
     AEGMVEQDER SKLYRLSIDF FALAASAGNP GDLRSICRPV LLRLCASLGD SIFLLARSGF       120
     DAICLDRSEG PFPIRSFTGD IGGRIALGVG QGALAILAFL PEAEREEVIR FNLSRVREYG       180
     VYDEVYLRTE IERVRQQGYA GRNTGLLEGM AGVAVPILDR EGRAVAALSV GTIADRLNAD       240
     RMPTVVELLK REAAAIGPKI NPFDATLRRP AQSLAGSPGG QKIALPEAPG PG               292
//

If you have problems or comments...

PBIL Back to PBIL home page