(data stored in ACNUC1104 zone)

EMBL: CP002417.PE322

CP002417.PE322       Location/Qualifiers
FT   CDS             complement(339250..339750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0323"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctt:CtCNB1_3401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34545"
FT                   /db_xref="GOA:E6V2B4"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B4"
FT                   /inference="similar to AA sequence:KEGG:CtCNB1_3401"
FT                   /protein_id="ADU34545.1"
FT                   /translation="MKLIHALYAAIHALMALAFAIASIVLVVIAARAGWGAVMQGLGLP
FT                   TAEAIIEAVGVLAAGVVALQISQTVLEEEVLREAHISAPTRVRRFLSRFMVVIVVAVAV
FT                   EGLVATFKAREAPELMLHAATMLGAVGLLMAGWGLFIRFNRYAEELEPEAMEEAKSEDR
FT                   KLK"
     MKLIHALYAA IHALMALAFA IASIVLVVIA ARAGWGAVMQ GLGLPTAEAI IEAVGVLAAG        60
     VVALQISQTV LEEEVLREAH ISAPTRVRRF LSRFMVVIVV AVAVEGLVAT FKAREAPELM       120
     LHAATMLGAV GLLMAGWGLF IRFNRYAEEL EPEAMEEAKS EDRKLK                      166
//

If you have problems or comments...

PBIL Back to PBIL home page