(data stored in ACNUC1104 zone)

EMBL: CP002417.PE323

CP002417.PE323       Location/Qualifiers
FT   CDS             339978..341516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0324"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: vap:Vapar_0310
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34546"
FT                   /db_xref="GOA:E6V2B5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B5"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADU34546.1"
FT                   /translation="MSEAQAILSVPTEVEQLLQRLGVPRTAYTGGELTVRSPVSGEVIA
FT                   QVPQTTAVEATGAIGRAHEAFKAWRNVPAPRRGELVRLLGEELRAAKRDLGSLVTLEAG
FT                   KIPSEGAGEVQEMIDICDFAVGLSRQLYGLTLATERAEHRMMETWHPLGVCGVISAFNF
FT                   PVAVWSWNAALALVCGDSVVWKPSEKTPLTALAVHAIAQRAIERFGDAPEGLLGLLLGQ
FT                   RDIGEVLVDDHRVPILSATGSTAMGRQVGPKLAARFARAILELGGNNAAIVTPSADLDL
FT                   TLRGIAFSAMGTAGQRCTTLRRLFVHDSVYDQLVPKLAKVYGNVQVGDPREAGTLVGPL
FT                   IDRAAFDGMQKALSESREIGAKVHGGSRVDGIGTQDAYYVRPALVELKSHDGPVLRETF
FT                   APILYVVRYSTLDEAIEWHNAVGAGLSSSIFTLNVREAERFMSSAGSDCGIANVNIGPS
FT                   GAEIGGAFGGEKETGGGREAGSDSWKAYMRRATNTINYSTALPLAQGVTFDIGD"
     MSEAQAILSV PTEVEQLLQR LGVPRTAYTG GELTVRSPVS GEVIAQVPQT TAVEATGAIG        60
     RAHEAFKAWR NVPAPRRGEL VRLLGEELRA AKRDLGSLVT LEAGKIPSEG AGEVQEMIDI       120
     CDFAVGLSRQ LYGLTLATER AEHRMMETWH PLGVCGVISA FNFPVAVWSW NAALALVCGD       180
     SVVWKPSEKT PLTALAVHAI AQRAIERFGD APEGLLGLLL GQRDIGEVLV DDHRVPILSA       240
     TGSTAMGRQV GPKLAARFAR AILELGGNNA AIVTPSADLD LTLRGIAFSA MGTAGQRCTT       300
     LRRLFVHDSV YDQLVPKLAK VYGNVQVGDP REAGTLVGPL IDRAAFDGMQ KALSESREIG       360
     AKVHGGSRVD GIGTQDAYYV RPALVELKSH DGPVLRETFA PILYVVRYST LDEAIEWHNA       420
     VGAGLSSSIF TLNVREAERF MSSAGSDCGI ANVNIGPSGA EIGGAFGGEK ETGGGREAGS       480
     DSWKAYMRRA TNTINYSTAL PLAQGVTFDI GD                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page