(data stored in ACNUC1104 zone)

EMBL: CP002417.PE325

CP002417.PE325       Location/Qualifiers
FT   CDS             342520..343737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0326"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   vap:Vapar_0312 aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34548"
FT                   /db_xref="GOA:E6V2B7"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B7"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADU34548.1"
FT                   /translation="MTDAAVFSPAQRVRAIHVSEILRITDHAQALKRAGRPVIVLGAGE
FT                   PDFDTPENIRHAASQAIARGDTRYTVLDGSPAMKAAVQLKFKRDNALDFAPDEISVSAG
FT                   AKQVIFNALMASLDPGDEVILPAPYWTSYADIVQICGGVPVSVACGEENGFRLTAAQLQ
FT                   AAITPRTRWLFLNSPSNPSGAAYSAAQLKPITDVLLDHSGVWVLADDIYEHILYDGLAF
FT                   ATPVAVEPRLRDRTLTVNGVSKAYAMTGWRVGYGAGPRALIAAMAVVQSQSTSCPSSVS
FT                   QAAAIEALTGPQGIVAERCASFQQRRDFVVAALNRTQGLHCRVPEGAFYTFASCAGVLG
FT                   KRTATGALLQTDSDFCRYLLQDFDVAVVPGSVFGLAPYFRISYATSMAQLEEACARISA
FT                   ACAALT"
     MTDAAVFSPA QRVRAIHVSE ILRITDHAQA LKRAGRPVIV LGAGEPDFDT PENIRHAASQ        60
     AIARGDTRYT VLDGSPAMKA AVQLKFKRDN ALDFAPDEIS VSAGAKQVIF NALMASLDPG       120
     DEVILPAPYW TSYADIVQIC GGVPVSVACG EENGFRLTAA QLQAAITPRT RWLFLNSPSN       180
     PSGAAYSAAQ LKPITDVLLD HSGVWVLADD IYEHILYDGL AFATPVAVEP RLRDRTLTVN       240
     GVSKAYAMTG WRVGYGAGPR ALIAAMAVVQ SQSTSCPSSV SQAAAIEALT GPQGIVAERC       300
     ASFQQRRDFV VAALNRTQGL HCRVPEGAFY TFASCAGVLG KRTATGALLQ TDSDFCRYLL       360
     QDFDVAVVPG SVFGLAPYFR ISYATSMAQL EEACARISAA CAALT                       405
//

If you have problems or comments...

PBIL Back to PBIL home page