(data stored in ACNUC1104 zone)

EMBL: CP002417.PE327

CP002417.PE327       Location/Qualifiers
FT   CDS             complement(345623..346717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0328"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34550"
FT                   /db_xref="InterPro:IPR021259"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2B9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0334"
FT                   /protein_id="ADU34550.1"
FT                   /translation="MIGIGEAFSPRYAQARQKFLQGCVSAGLTVEPHAHPLKGRDGEDL
FT                   SMDVALDGDANAERLLLVTSACHGVEGHCGSGVQVFALHDAEWRDKAKAQGVAVLYVHA
FT                   LNPHGFSYARRVTHENVDLNRNFIDFSQPVPVNEPYAKLHPLLLPDTWPPTPENQAAVE
FT                   KWIEKHGTTAYQAAVTSGQYQFDDGLFFGGKAPTWSNKTIRGVLRRHAGNAKRIAWIDL
FT                   HTGLGPNGLGERIYAGKDDKTAYARANAWWGTPAAPVTSIYDGSSTSALLRGLMWDAVY
FT                   EECPKAEYTGIALEYGTLPILEVTGALRADHWLHKHPDAPADLADGIRARMVEAFYTDT
FT                   DAWRGQIVSQARQAMFQAVDGLNG"
     MIGIGEAFSP RYAQARQKFL QGCVSAGLTV EPHAHPLKGR DGEDLSMDVA LDGDANAERL        60
     LLVTSACHGV EGHCGSGVQV FALHDAEWRD KAKAQGVAVL YVHALNPHGF SYARRVTHEN       120
     VDLNRNFIDF SQPVPVNEPY AKLHPLLLPD TWPPTPENQA AVEKWIEKHG TTAYQAAVTS       180
     GQYQFDDGLF FGGKAPTWSN KTIRGVLRRH AGNAKRIAWI DLHTGLGPNG LGERIYAGKD       240
     DKTAYARANA WWGTPAAPVT SIYDGSSTSA LLRGLMWDAV YEECPKAEYT GIALEYGTLP       300
     ILEVTGALRA DHWLHKHPDA PADLADGIRA RMVEAFYTDT DAWRGQIVSQ ARQAMFQAVD       360
     GLNG                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page