(data stored in ACNUC1104 zone)

EMBL: CP002417.PE328

CP002417.PE328       Location/Qualifiers
FT   CDS             complement(346714..347919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0329"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="TIGRFAM: amidohydrolase; KEGG: vap:Vapar_0333
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34551"
FT                   /db_xref="GOA:E6V2C0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C0"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ADU34551.1"
FT                   /translation="MKLIDSLVTQAAGIAAVRRDLHAHPELCFQEVRTADVVAGKLTEW
FT                   GIPIHRGLGTTGVVGIVKNGTSNRAVGLRADMDALPVTELNTFAHASKHHGKMHACGHD
FT                   GHTAMLLAAAQHLAKNRNFDGTVYLIFQPAEEGGGGAREMIKEGLFEQFPMDAVFGMHN
FT                   WPGMKAGQFAVSPGPVMASGNKFFVNVIGKGGHAALPQTGIDPVPIACEIVQAFQTVLT
FT                   RKMKPTDSAVISVTTIHAGEANNVIPDNCELSGTVRTFSIEVLDMIEAKMRQIAEHICA
FT                   AHDATCDFRFERYYPPTINTEAEAHFARDVMAGIVGPENVLKQEAAMTSEDFAFMLQAK
FT                   PGAYAFIGNGDGTHRDVHHGEGPCTLHNASYDFNDDLIPLGATCWVQIAEQFLNKPGGN
FT                   VS"
     MKLIDSLVTQ AAGIAAVRRD LHAHPELCFQ EVRTADVVAG KLTEWGIPIH RGLGTTGVVG        60
     IVKNGTSNRA VGLRADMDAL PVTELNTFAH ASKHHGKMHA CGHDGHTAML LAAAQHLAKN       120
     RNFDGTVYLI FQPAEEGGGG AREMIKEGLF EQFPMDAVFG MHNWPGMKAG QFAVSPGPVM       180
     ASGNKFFVNV IGKGGHAALP QTGIDPVPIA CEIVQAFQTV LTRKMKPTDS AVISVTTIHA       240
     GEANNVIPDN CELSGTVRTF SIEVLDMIEA KMRQIAEHIC AAHDATCDFR FERYYPPTIN       300
     TEAEAHFARD VMAGIVGPEN VLKQEAAMTS EDFAFMLQAK PGAYAFIGNG DGTHRDVHHG       360
     EGPCTLHNAS YDFNDDLIPL GATCWVQIAE QFLNKPGGNV S                           401
//

If you have problems or comments...

PBIL Back to PBIL home page