(data stored in SCRATCH zone)

EMBL: CP002417.PE329

CP002417.PE329       Location/Qualifiers
FT   CDS             complement(347998..349191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0330"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: vap:Vapar_0332 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34552"
FT                   /db_xref="GOA:E6V2C1"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C1"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ADU34552.1"
FT                   /translation="MRTLQIALTATAALCVAACSGTGPSGPAKLLTLDGNPPLVIAHRG
FT                   ASGYLPEQTLEAYAKAIELGADVIEMDLVSTKDGVLIARHDPNLAISTDVAKHARFASR
FT                   KKTIKVDGETQTGWFSNDFTLAEIKTLGGISTDAERPQEFNGKFKIVTFQEIIDFAKAK
FT                   SKETGRTIAIYPETKNPTYFRDLGMPMEDKVVAAINAAGWNSKTAPIYVQSFEPGSLKY
FT                   MKAKGLNTKLIQLIDGDGIDMKTGAMTYAIPVDRPYEWTKAGDTRNFDVMVTPAGLAEI
FT                   KTYADGIGPWKRYIVTIKGSIGPDGKPLDVNKDGKVNDADATSVSPTTLIADAHKAGLF
FT                   VHPFTFRNESRRLAADYNKDGKNEYAIYYKLGVDGVFTDFTDTALAARADYLKSMGR"
     MRTLQIALTA TAALCVAACS GTGPSGPAKL LTLDGNPPLV IAHRGASGYL PEQTLEAYAK        60
     AIELGADVIE MDLVSTKDGV LIARHDPNLA ISTDVAKHAR FASRKKTIKV DGETQTGWFS       120
     NDFTLAEIKT LGGISTDAER PQEFNGKFKI VTFQEIIDFA KAKSKETGRT IAIYPETKNP       180
     TYFRDLGMPM EDKVVAAINA AGWNSKTAPI YVQSFEPGSL KYMKAKGLNT KLIQLIDGDG       240
     IDMKTGAMTY AIPVDRPYEW TKAGDTRNFD VMVTPAGLAE IKTYADGIGP WKRYIVTIKG       300
     SIGPDGKPLD VNKDGKVNDA DATSVSPTTL IADAHKAGLF VHPFTFRNES RRLAADYNKD       360
     GKNEYAIYYK LGVDGVFTDF TDTALAARAD YLKSMGR                                397
//

If you have problems or comments...

PBIL Back to PBIL home page