(data stored in ACNUC1104 zone)

EMBL: CP002417.PE33

CP002417.PE33        Location/Qualifiers
FT   CDS             35575..37827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0033"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: vap:Vapar_0031 heavy metal translocating
FT                   P-type ATPase; TIGRFAM: heavy metal translocating P-type
FT                   ATPase; copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34256"
FT                   /db_xref="GOA:E6UXR2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR2"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADU34256.1"
FT                   /translation="METLQQHPSAATANATTLDLSVGGMTCASCVMRVERALKNVPGVQ
FT                   AVSVNLATESARVVTTDAEDMDARLRRAVRAAGYEPRAASSAADEAAALSPWHGVGPVA
FT                   IGLALSIPLLAPMLGDPFGQDWMLPPWLQLLLAAPVQFWLGARFYRAGWHAAKARTGNM
FT                   DLLVALGTSAAFGLSLWLWWRSATGEHAGHGEMPHLYFEAAAVVITLVLLGKWLEARAK
FT                   RQATSAIRALQQLRPEVAHLVGARGESDVPLAEVMVGDRLAVRPGERVPADARVIEGQS
FT                   EVDESMLTGEPLPVAKGPGDALTGGAVNGDGRMVIEVSAIGAESVLARIIRLVEDAQAA
FT                   KAPIQRLVDKVAAVFVPVVLVIALLTLAGWLIAGAGIETALIYAVAVLVIACPCALGLA
FT                   TPVAVMAGTGVAARHGILIKDARSLEIAHRVDTVAFDKTGTLTLGRPVLTALLPVASIE
FT                   ATENQLLATAASLQGGSEHPLARAVLAAAVQRGVQAPPLGAMQAMPGRGVRGEVNGATW
FT                   AIASLRWCRELDAMPAEAEVESLQAQGATVSALLRFDEAGAAHVQALLAFADEPKPQAA
FT                   EAIRTLRARGLRVVMISGDNLRAAQAMAARLGIAIEDVRADVLPADKAAQVSALRRDGH
FT                   VVAMVGDGANDAPALAAADVGIAMAPSGGGTDVAMEAAGITLMRGDLALVAQAFELSAR
FT                   TVAKIRQNLFWAFAYNVAGIPLAAFGLLSPVVAGAAMALSSVSVMANALLLRRWKP"
     METLQQHPSA ATANATTLDL SVGGMTCASC VMRVERALKN VPGVQAVSVN LATESARVVT        60
     TDAEDMDARL RRAVRAAGYE PRAASSAADE AAALSPWHGV GPVAIGLALS IPLLAPMLGD       120
     PFGQDWMLPP WLQLLLAAPV QFWLGARFYR AGWHAAKART GNMDLLVALG TSAAFGLSLW       180
     LWWRSATGEH AGHGEMPHLY FEAAAVVITL VLLGKWLEAR AKRQATSAIR ALQQLRPEVA       240
     HLVGARGESD VPLAEVMVGD RLAVRPGERV PADARVIEGQ SEVDESMLTG EPLPVAKGPG       300
     DALTGGAVNG DGRMVIEVSA IGAESVLARI IRLVEDAQAA KAPIQRLVDK VAAVFVPVVL       360
     VIALLTLAGW LIAGAGIETA LIYAVAVLVI ACPCALGLAT PVAVMAGTGV AARHGILIKD       420
     ARSLEIAHRV DTVAFDKTGT LTLGRPVLTA LLPVASIEAT ENQLLATAAS LQGGSEHPLA       480
     RAVLAAAVQR GVQAPPLGAM QAMPGRGVRG EVNGATWAIA SLRWCRELDA MPAEAEVESL       540
     QAQGATVSAL LRFDEAGAAH VQALLAFADE PKPQAAEAIR TLRARGLRVV MISGDNLRAA       600
     QAMAARLGIA IEDVRADVLP ADKAAQVSAL RRDGHVVAMV GDGANDAPAL AAADVGIAMA       660
     PSGGGTDVAM EAAGITLMRG DLALVAQAFE LSARTVAKIR QNLFWAFAYN VAGIPLAAFG       720
     LLSPVVAGAA MALSSVSVMA NALLLRRWKP                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page