(data stored in ACNUC1104 zone)

EMBL: CP002417.PE330

CP002417.PE330       Location/Qualifiers
FT   CDS             349292..350458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0331"
FT                   /product="acetylornithine deacetylase (ArgE)"
FT                   /note="KEGG: vap:Vapar_0331 acetylornithine deacetylase
FT                   (ArgE); TIGRFAM: acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34553"
FT                   /db_xref="GOA:E6V2C2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C2"
FT                   /inference="protein motif:TFAM:TIGR01892"
FT                   /protein_id="ADU34553.1"
FT                   /translation="MPHTLSPQSLALAQSLVRMNTVSENSNLQLIDLAQSHLAALGVKS
FT                   RITYNAERTKANLFATLGEGKPAGVIISGHTDTVPWDGQDWSVDPLSAVVQHERLYGRG
FT                   SADMKSFIAIALSNAKRFLESDSPFAVHFAFSYEEEIGCFGVKELIADMRDAGIKPLAC
FT                   IVGEPTSMVPAIAHKGVYRYKCCVRGKEAHSSLTPKSVNAIEMAARVIGKVRDMAEDFE
FT                   RSEPRYEGFDVPFSTASVGQFHGGIADNVVPRDAEFRYEFRDLPTADAKRMQSDVLAYA
FT                   AGLEPAMKKVAPDAGFKFETICEIPSFLGAANDPVTLLAQRLAGEDRTTLVAFGTEAGL
FT                   FKNAGIPTVVCGPGSIEQAHQPDEFVSLEQLARCELFMERLATSHTIG"
     MPHTLSPQSL ALAQSLVRMN TVSENSNLQL IDLAQSHLAA LGVKSRITYN AERTKANLFA        60
     TLGEGKPAGV IISGHTDTVP WDGQDWSVDP LSAVVQHERL YGRGSADMKS FIAIALSNAK       120
     RFLESDSPFA VHFAFSYEEE IGCFGVKELI ADMRDAGIKP LACIVGEPTS MVPAIAHKGV       180
     YRYKCCVRGK EAHSSLTPKS VNAIEMAARV IGKVRDMAED FERSEPRYEG FDVPFSTASV       240
     GQFHGGIADN VVPRDAEFRY EFRDLPTADA KRMQSDVLAY AAGLEPAMKK VAPDAGFKFE       300
     TICEIPSFLG AANDPVTLLA QRLAGEDRTT LVAFGTEAGL FKNAGIPTVV CGPGSIEQAH       360
     QPDEFVSLEQ LARCELFMER LATSHTIG                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page