(data stored in SCRATCH zone)

EMBL: CP002417.PE331

CP002417.PE331       Location/Qualifiers
FT   CDS             350490..351713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0332"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   vap:Vapar_0330 protein of unknown function DUF445"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34554"
FT                   /db_xref="GOA:E6V2C3"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C3"
FT                   /inference="protein motif:PFAM:PF04286"
FT                   /protein_id="ADU34554.1"
FT                   /translation="MKRVALGLLCAAALLYALASALHAQHPAWGYVAAFAEAAMVGAIA
FT                   DWFAVVALFRHPLGLPIPHTAIIPSNKDRIGAKLAGFICNNFLSTAQVLAKLREFDTAG
FT                   RIADWLARPASGEKLGEWGVAATRYGLTAFDDDRVRDFMGRAAAAGLEKIDLSRLTGQA
FT                   LDALTAGGRHQALLDDVLQQVAGLLEGEEVQAHITEAIAREIKTLRYVGLDQVAAKLAT
FT                   RKIVAAVAHTIGELAAEPDHPMRKRFDHFVDDFVVRLKLDPEFQQRGEQIRAELMAHPA
FT                   LGDYLHGLWGELLAWLDRDLRRGDSTIRQRIASMAGALGTRLQADEAIRHWINEQIEAA
FT                   APLAIERYREDIRRYIEERVGEWNAEEMTVELERHIGRDLQFIRINGTLVGGLVGLAIH
FT                   TATQLLRG"
     MKRVALGLLC AAALLYALAS ALHAQHPAWG YVAAFAEAAM VGAIADWFAV VALFRHPLGL        60
     PIPHTAIIPS NKDRIGAKLA GFICNNFLST AQVLAKLREF DTAGRIADWL ARPASGEKLG       120
     EWGVAATRYG LTAFDDDRVR DFMGRAAAAG LEKIDLSRLT GQALDALTAG GRHQALLDDV       180
     LQQVAGLLEG EEVQAHITEA IAREIKTLRY VGLDQVAAKL ATRKIVAAVA HTIGELAAEP       240
     DHPMRKRFDH FVDDFVVRLK LDPEFQQRGE QIRAELMAHP ALGDYLHGLW GELLAWLDRD       300
     LRRGDSTIRQ RIASMAGALG TRLQADEAIR HWINEQIEAA APLAIERYRE DIRRYIEERV       360
     GEWNAEEMTV ELERHIGRDL QFIRINGTLV GGLVGLAIHT ATQLLRG                     407
//

If you have problems or comments...

PBIL Back to PBIL home page