(data stored in SCRATCH zone)

EMBL: CP002417.PE333

CP002417.PE333       Location/Qualifiers
FT   CDS             353676..354452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0334"
FT                   /product="putative integral membrane sensor protein"
FT                   /note="PFAM: MHYT domain protein; KEGG: vap:Vapar_0328
FT                   putative integral membrane sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34556"
FT                   /db_xref="GOA:E6V2C5"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C5"
FT                   /inference="protein motif:PFAM:PF03707"
FT                   /protein_id="ADU34556.1"
FT                   /translation="MTPLVVGQLLSPEYSLGLVALSFLISFAGSLVALICAGRMVNADG
FT                   KPNLALVACAAVALGGIGIWSMHFIGMLAYRLPVAISYNMPLTIVSLVAAILISGIALY
FT                   LAGGRRKFSKPGWAAGSLLAGVGVCVMHYMGMFAMNMRATMELDMGTVALSVVIAITAA
FT                   AAALWLAFNLRKLSHQIGAAAVMGVAVCTMHYVGMTAASMICTAAAPTDALAIGGSYMG
FT                   LSVFGTAGAVLIFIYWVATGNSLDAPTPQRARPRTS"
     MTPLVVGQLL SPEYSLGLVA LSFLISFAGS LVALICAGRM VNADGKPNLA LVACAAVALG        60
     GIGIWSMHFI GMLAYRLPVA ISYNMPLTIV SLVAAILISG IALYLAGGRR KFSKPGWAAG       120
     SLLAGVGVCV MHYMGMFAMN MRATMELDMG TVALSVVIAI TAAAAALWLA FNLRKLSHQI       180
     GAAAVMGVAV CTMHYVGMTA ASMICTAAAP TDALAIGGSY MGLSVFGTAG AVLIFIYWVA       240
     TGNSLDAPTP QRARPRTS                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page