(data stored in ACNUC1104 zone)

EMBL: CP002417.PE337

CP002417.PE337       Location/Qualifiers
FT   CDS             359070..360230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0338"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: vap:Vapar_0324 acyl-CoA dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34560"
FT                   /db_xref="GOA:E6V2C9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2C9"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADU34560.1"
FT                   /translation="MQYTHEHLEIQKTLRRFIDDEINPHVDEWEAAEIFPAHEVFKKLG
FT                   NLGMLGLNKPEAFGGAGLDYSYAMAMAEALGHVSCGGVPMAIGVQTDMCTPALARFGSD
FT                   ELRREFLAPAIAGDTVGCIGVSEPGAGSDVAGLKSHARKDGDDYLISGQKMWITNSLQA
FT                   DWMCMLVNTSDGPVHRNKSLVMVPMDSPGIEKAKKIRKIGMNSSDTGLIYFDNVRVPQR
FT                   YRIGEEGQGFVYQMQQFQEERLWAAASSLEPMEDCIAQTIEWAQQRHMFGGTLADQQWV
FT                   QFKLAELKTEVEALRALTYRACDLHVQGEDVLELASMAKLKTGRLTRQVSDTCLQFWGG
FT                   MGFTLENRVSRLYRDGRLGSIGGGADEVMLGILAKTMGIAKRPPRG"
     MQYTHEHLEI QKTLRRFIDD EINPHVDEWE AAEIFPAHEV FKKLGNLGML GLNKPEAFGG        60
     AGLDYSYAMA MAEALGHVSC GGVPMAIGVQ TDMCTPALAR FGSDELRREF LAPAIAGDTV       120
     GCIGVSEPGA GSDVAGLKSH ARKDGDDYLI SGQKMWITNS LQADWMCMLV NTSDGPVHRN       180
     KSLVMVPMDS PGIEKAKKIR KIGMNSSDTG LIYFDNVRVP QRYRIGEEGQ GFVYQMQQFQ       240
     EERLWAAASS LEPMEDCIAQ TIEWAQQRHM FGGTLADQQW VQFKLAELKT EVEALRALTY       300
     RACDLHVQGE DVLELASMAK LKTGRLTRQV SDTCLQFWGG MGFTLENRVS RLYRDGRLGS       360
     IGGGADEVML GILAKTMGIA KRPPRG                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page