(data stored in ACNUC1104 zone)

EMBL: CP002417.PE338

CP002417.PE338       Location/Qualifiers
FT   CDS             360246..361424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0339"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: ctt:CtCNB1_1722 acyl-CoA dehydrogenase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34561"
FT                   /db_xref="GOA:E6V2D0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D0"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADU34561.1"
FT                   /translation="MDAELQADRAALADTVRRFAENEIAPNVEAWDDAGEFPRALYTRA
FT                   AELGLLGLGYAEAFGGTPASYSLKLPAWIALARHGKSGGVLASLFSHNIGLPPVVLHAS
FT                   DAVRHEVVPAVLRGEKIAALAITEPGGGSDVAALRTTARRESAGDGDHYVLNGEKTFIT
FT                   SGMRAHWITVAVRTGEGRGAGGISMLLVPGDALGLSRKRLTKMGWWCSDTATLHFDNVR
FT                   VPARYLLGDEGAGFRMIMGNFNGERIGLAAGALGFAQACLDEALAWSRERKTFGAALIE
FT                   HQAVRHKLVDMQMRIASTEAWLEAVSAEGDAHEAAGRFNAPEWVAQVCMLKNHATQTMQ
FT                   FCADQAVQILGGMGFMRGTVSERIYREVKVMMIGGGAEEIMKELAARQLGWL"
     MDAELQADRA ALADTVRRFA ENEIAPNVEA WDDAGEFPRA LYTRAAELGL LGLGYAEAFG        60
     GTPASYSLKL PAWIALARHG KSGGVLASLF SHNIGLPPVV LHASDAVRHE VVPAVLRGEK       120
     IAALAITEPG GGSDVAALRT TARRESAGDG DHYVLNGEKT FITSGMRAHW ITVAVRTGEG       180
     RGAGGISMLL VPGDALGLSR KRLTKMGWWC SDTATLHFDN VRVPARYLLG DEGAGFRMIM       240
     GNFNGERIGL AAGALGFAQA CLDEALAWSR ERKTFGAALI EHQAVRHKLV DMQMRIASTE       300
     AWLEAVSAEG DAHEAAGRFN APEWVAQVCM LKNHATQTMQ FCADQAVQIL GGMGFMRGTV       360
     SERIYREVKV MMIGGGAEEI MKELAARQLG WL                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page