(data stored in SCRATCH zone)

EMBL: CP002417.PE339

CP002417.PE339       Location/Qualifiers
FT   CDS             361590..361910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0340"
FT                   /product="Stress responsive alpha-beta barrel
FT                   domain-containing protein"
FT                   /note="PFAM: Stress responsive alpha-beta barrel
FT                   domain-containing protein; KEGG: reu:Reut_B4139 antibiotic
FT                   biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34562"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D1"
FT                   /inference="protein motif:PFAM:PF07876"
FT                   /protein_id="ADU34562.1"
FT                   /translation="MTEARTMFKHIVMWDLRGESPEEKAEAVQLLKRKFESLRGQIPGL
FT                   LHLEVGVDSSRIAYACDVVLYSEFDSQASLDGYATHPAHLRVREELGDLRIARHQVDYA
FT                   ME"
     MTEARTMFKH IVMWDLRGES PEEKAEAVQL LKRKFESLRG QIPGLLHLEV GVDSSRIAYA        60
     CDVVLYSEFD SQASLDGYAT HPAHLRVREE LGDLRIARHQ VDYAME                      106
//

If you have problems or comments...

PBIL Back to PBIL home page