(data stored in ACNUC1104 zone)

EMBL: CP002417.PE34

CP002417.PE34        Location/Qualifiers
FT   CDS             complement(37953..38435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0034"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   vap:Vapar_0032 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34257"
FT                   /db_xref="GOA:E6UXR3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADU34257.1"
FT                   /translation="MRRLATLEDLHAVFTLYMHEKVVPYLGYDPMPLEEFRPIYQEMLE
FT                   SRRFFVYELDGRVAGFYRATRYPGRVQHVASLGTLAVDPTLHGKGVALAMVSQAIDELK
FT                   AAGVKRIELCVESDNAPGLRFYEKLGFQREGTLRKFYKRASDAEAIDDHMMALLFD"
     MRRLATLEDL HAVFTLYMHE KVVPYLGYDP MPLEEFRPIY QEMLESRRFF VYELDGRVAG        60
     FYRATRYPGR VQHVASLGTL AVDPTLHGKG VALAMVSQAI DELKAAGVKR IELCVESDNA       120
     PGLRFYEKLG FQREGTLRKF YKRASDAEAI DDHMMALLFD                             160
//

If you have problems or comments...

PBIL Back to PBIL home page