(data stored in ACNUC1104 zone)

EMBL: CP002417.PE345

CP002417.PE345       Location/Qualifiers
FT   CDS             365174..366685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0346"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; KEGG: vap:Vapar_0317 protein of unknown
FT                   function DUF112 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34568"
FT                   /db_xref="GOA:E6V2D7"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D7"
FT                   /inference="protein motif:PFAM:PF01970"
FT                   /protein_id="ADU34568.1"
FT                   /translation="MDLIHNLSIGFGVAFTFTNLLYCLLGCILGTLIGVLPGIGPVATI
FT                   AMLLPATYALPPVSALIMLAGIYYGAQYGGSTTAILVNLPGESSSVVTCIDGYQMARQG
FT                   RAGPALAAAGLGSFFAGCVGTLILAAFAPPLTELAFKFGPAEYFSLMTLGLIGAVVLAS
FT                   GSLLKAVAMIVLGLLLGIVGTDVNSGVARFSFDIPELTDGIGFVVIAMGVFGYGEIIGN
FT                   LSQPDDEREVFTHKVKGLWPTKDDFKRMTPAVLRGTALGSALGILPGGGALLAAFAAYA
FT                   LEKKIKMRPGEVPFGKGNIRGVASPESANNAGAQTSFIPLLTLGIPPNAVMALMVGAMT
FT                   IHNIQPGPQVMTSNPELFWGLIASMWIGNAMLIILNLPLIGMWIKLLTVPYKFLFPAIV
FT                   LFCAIGVYSTNNNTFDVWMVAIFGFIGYLFLKLKTEPAPLLLGFILGPMMEENLRRALL
FT                   LSRGAWSVFVTRPLSAGLLVAAAALLCIVLLPSIKAKREEAFVEE"
     MDLIHNLSIG FGVAFTFTNL LYCLLGCILG TLIGVLPGIG PVATIAMLLP ATYALPPVSA        60
     LIMLAGIYYG AQYGGSTTAI LVNLPGESSS VVTCIDGYQM ARQGRAGPAL AAAGLGSFFA       120
     GCVGTLILAA FAPPLTELAF KFGPAEYFSL MTLGLIGAVV LASGSLLKAV AMIVLGLLLG       180
     IVGTDVNSGV ARFSFDIPEL TDGIGFVVIA MGVFGYGEII GNLSQPDDER EVFTHKVKGL       240
     WPTKDDFKRM TPAVLRGTAL GSALGILPGG GALLAAFAAY ALEKKIKMRP GEVPFGKGNI       300
     RGVASPESAN NAGAQTSFIP LLTLGIPPNA VMALMVGAMT IHNIQPGPQV MTSNPELFWG       360
     LIASMWIGNA MLIILNLPLI GMWIKLLTVP YKFLFPAIVL FCAIGVYSTN NNTFDVWMVA       420
     IFGFIGYLFL KLKTEPAPLL LGFILGPMME ENLRRALLLS RGAWSVFVTR PLSAGLLVAA       480
     AALLCIVLLP SIKAKREEAF VEE                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page