(data stored in ACNUC1104 zone)

EMBL: CP002417.PE347

CP002417.PE347       Location/Qualifiers
FT   CDS             368587..368889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0348"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34570"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2D9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0314"
FT                   /protein_id="ADU34570.1"
FT                   /translation="MPSMSESERIALAARLHVALRRKHGRVTDTEWMATNAEYAAEIVR
FT                   MTRAHAAETKDEELDQLATRLELAMEPLARAARLAARQPDGTPPTPPPRYVGGLR"
     MPSMSESERI ALAARLHVAL RRKHGRVTDT EWMATNAEYA AEIVRMTRAH AAETKDEELD        60
     QLATRLELAM EPLARAARLA ARQPDGTPPT PPPRYVGGLR                             100
//

If you have problems or comments...

PBIL Back to PBIL home page