(data stored in ACNUC1104 zone)

EMBL: CP002417.PE348

CP002417.PE348       Location/Qualifiers
FT   CDS             complement(368952..370079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0349"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   vap:Vapar_0335 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34571"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E0"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU34571.1"
FT                   /translation="MVNRRHFSLAVGTAATLASFRIAQAQTEAPLVLGQSAPFTGPAAQ
FT                   LGIQFHQGAKVFLDQYNAQSGRRNVVIKNLDDGYEPDRCAANTQKLIEEDVFALFGYIG
FT                   TPTSLAALPLAVKDKVPFIAPFTGAMSLREPFQKNVFHLRASYNDETALMVKQLTHLGL
FT                   KKIAVFYQNDAYGKAGLDGVTLALSQLDLKPVAMATVERNSADVAQAVKSIVGAKPDAV
FT                   VQVGAYKACAAFIREARKASYGGTFINLSFVGTQALADELGKEAAGVMVTQVVPSPYNP
FT                   ANAITREFVEAVRKAGGGASANFSSMEGYLAAKVLTEGLRKASGKLTRDSLVAGLESID
FT                   RQQFGGFEVSFSAKNHVGSKFVELSMLTGDGRVRT"
     MVNRRHFSLA VGTAATLASF RIAQAQTEAP LVLGQSAPFT GPAAQLGIQF HQGAKVFLDQ        60
     YNAQSGRRNV VIKNLDDGYE PDRCAANTQK LIEEDVFALF GYIGTPTSLA ALPLAVKDKV       120
     PFIAPFTGAM SLREPFQKNV FHLRASYNDE TALMVKQLTH LGLKKIAVFY QNDAYGKAGL       180
     DGVTLALSQL DLKPVAMATV ERNSADVAQA VKSIVGAKPD AVVQVGAYKA CAAFIREARK       240
     ASYGGTFINL SFVGTQALAD ELGKEAAGVM VTQVVPSPYN PANAITREFV EAVRKAGGGA       300
     SANFSSMEGY LAAKVLTEGL RKASGKLTRD SLVAGLESID RQQFGGFEVS FSAKNHVGSK       360
     FVELSMLTGD GRVRT                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page