(data stored in ACNUC1104 zone)

EMBL: CP002417.PE35

CP002417.PE35        Location/Qualifiers
FT   CDS             complement(38484..39611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0035"
FT                   /product="fatty acid hydroxylase"
FT                   /note="PFAM: fatty acid hydroxylase; KEGG: ajs:Ajs_3693
FT                   YhhN family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34258"
FT                   /db_xref="GOA:E6UXR4"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR4"
FT                   /inference="protein motif:PFAM:PF04116"
FT                   /protein_id="ADU34258.1"
FT                   /translation="MHRLVVLVVPVFALLMACEFAWGWFKRRNTYRFSDTLGSLSQGLL
FT                   SQALAVCTQLFQIGLYAMVYPLVAIWTRPAFWNSAIGWIVAVLLFDFCDYWLHRAGHES
FT                   AVFWAAHSVHHQSQQFNFSTALRQESMVAFLGWAFYLPMAVVGVPPEQFGIAGLIVLVY
FT                   QFWIHTEHIGKLGWFDRVFSSPSNHRVHHAVNDGYVDRNYGGMLVVWDRMFGTFAEENE
FT                   RAVYGTRKALASFDPVRAILGPYVPLVRDSWHTRRWRDKLAVWFKPPGWRPADVAARFP
FT                   EAPFSLDEAMHIHDPALTRVQVVSASIHFIGWIGVTLAFLWGADDLVFRTGLELLALAI
FT                   AGFWTIGAVLDSRIRLRWAWCAQCALLAFSVALLA"
     MHRLVVLVVP VFALLMACEF AWGWFKRRNT YRFSDTLGSL SQGLLSQALA VCTQLFQIGL        60
     YAMVYPLVAI WTRPAFWNSA IGWIVAVLLF DFCDYWLHRA GHESAVFWAA HSVHHQSQQF       120
     NFSTALRQES MVAFLGWAFY LPMAVVGVPP EQFGIAGLIV LVYQFWIHTE HIGKLGWFDR       180
     VFSSPSNHRV HHAVNDGYVD RNYGGMLVVW DRMFGTFAEE NERAVYGTRK ALASFDPVRA       240
     ILGPYVPLVR DSWHTRRWRD KLAVWFKPPG WRPADVAARF PEAPFSLDEA MHIHDPALTR       300
     VQVVSASIHF IGWIGVTLAF LWGADDLVFR TGLELLALAI AGFWTIGAVL DSRIRLRWAW       360
     CAQCALLAFS VALLA                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page