(data stored in ACNUC1104 zone)

EMBL: CP002417.PE350

CP002417.PE350       Location/Qualifiers
FT   CDS             372206..373330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0351"
FT                   /product="aminopeptidase"
FT                   /note="PFAM: aminopeptidase; KEGG: vap:Vapar_0337 putative
FT                   zinc protease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34573"
FT                   /db_xref="GOA:E6V2E2"
FT                   /db_xref="InterPro:IPR014553"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E2"
FT                   /inference="protein motif:PFAM:PF10023"
FT                   /protein_id="ADU34573.1"
FT                   /translation="MRGLSALALAGALFLTGCADLGYYWQSASGHIGIMRAAKPVPEWL
FT                   ADPATSAPLKAKLELTQRIRRFASAELGLPDNASYKSYADLHRPAAVWNVVAAPPYSLT
FT                   LKNWCFPVAGCVGYRGYYSEDAAKAEAEAQRALDLEVAVYPVPAYSTLGWMNWAGGDPL
FT                   LSTFIGYPEGELARLVFHELAHQVLYVPGDTVFNESYATAVERIGGGMWLQREAGEAAR
FT                   REYAQFDGQRQEFRALALNTRRALTQVYESPEAKAKDWPAVEAMKKAAMADFRARYAEL
FT                   KQGWQGPRQNAYDGWVARANNAAFGAQGAYDDLVPAFEALFDREGRDWPRFYTEVRRIA
FT                   ALPTTEERRSALQTATGILQTHSSEDNNNGEHGA"
     MRGLSALALA GALFLTGCAD LGYYWQSASG HIGIMRAAKP VPEWLADPAT SAPLKAKLEL        60
     TQRIRRFASA ELGLPDNASY KSYADLHRPA AVWNVVAAPP YSLTLKNWCF PVAGCVGYRG       120
     YYSEDAAKAE AEAQRALDLE VAVYPVPAYS TLGWMNWAGG DPLLSTFIGY PEGELARLVF       180
     HELAHQVLYV PGDTVFNESY ATAVERIGGG MWLQREAGEA ARREYAQFDG QRQEFRALAL       240
     NTRRALTQVY ESPEAKAKDW PAVEAMKKAA MADFRARYAE LKQGWQGPRQ NAYDGWVARA       300
     NNAAFGAQGA YDDLVPAFEA LFDREGRDWP RFYTEVRRIA ALPTTEERRS ALQTATGILQ       360
     THSSEDNNNG EHGA                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page