(data stored in ACNUC1104 zone)

EMBL: CP002417.PE351

CP002417.PE351       Location/Qualifiers
FT   CDS             373323..373637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0352"
FT                   /product="polyhydroxyalkanoic acid system protein"
FT                   /note="TIGRFAM: polyhydroxyalkanoic acid system protein;
FT                   KEGG: vap:Vapar_0338 polyhydroxyalkanoic acid system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34574"
FT                   /db_xref="InterPro:IPR013433"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E3"
FT                   /inference="protein motif:TFAM:TIGR02610"
FT                   /protein_id="ADU34574.1"
FT                   /translation="MPDIHIERNHTLGIAGAREVARQWVQQVEQDYGLECTYTEGKTCD
FT                   VARFSRPGIDGTVEVTADTFKLEATLGFLFSSFSEQIEQKISRNLDALLESPNGGTRFA
FT                   "
     MPDIHIERNH TLGIAGAREV ARQWVQQVEQ DYGLECTYTE GKTCDVARFS RPGIDGTVEV        60
     TADTFKLEAT LGFLFSSFSE QIEQKISRNL DALLESPNGG TRFA                        104
//

If you have problems or comments...

PBIL Back to PBIL home page