(data stored in ACNUC1104 zone)

EMBL: CP002417.PE352

CP002417.PE352       Location/Qualifiers
FT   CDS             complement(373843..374580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0353"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   vap:Vapar_0339 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34575"
FT                   /db_xref="GOA:E6V2E4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU34575.1"
FT                   /translation="MTTSFDFSRRRALVTGASSGIGRAVALQLAQSGATVTAVGRNAAA
FT                   LDALHAEAGCTPLVIDVSDAAALERALATLPAFDLVVNCAGIALLESALDLQAESFDAV
FT                   MAVNARAAALVASRCGKAMIASGVRGSIVNVSSQASLVALDAHLCYCASKAAMDAITRS
FT                   LCLEFGPHGIRVNSVNPTVTLTPMAAEAWADPAKSAAVLRSIPMGRFAEVGEVVAPILF
FT                   LLSDGASMVSGVALPVDGGYTIV"
     MTTSFDFSRR RALVTGASSG IGRAVALQLA QSGATVTAVG RNAAALDALH AEAGCTPLVI        60
     DVSDAAALER ALATLPAFDL VVNCAGIALL ESALDLQAES FDAVMAVNAR AAALVASRCG       120
     KAMIASGVRG SIVNVSSQAS LVALDAHLCY CASKAAMDAI TRSLCLEFGP HGIRVNSVNP       180
     TVTLTPMAAE AWADPAKSAA VLRSIPMGRF AEVGEVVAPI LFLLSDGASM VSGVALPVDG       240
     GYTIV                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page