(data stored in ACNUC1104 zone)

EMBL: CP002417.PE353

CP002417.PE353       Location/Qualifiers
FT   CDS             complement(374577..376103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0354"
FT                   /product="Xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="KEGG: vap:Vapar_0340 xylulokinase; PFAM:
FT                   Carbohydrate kinase, FGGY-like"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34576"
FT                   /db_xref="GOA:E6V2E5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E5"
FT                   /inference="protein motif:PRIAM:2.7.1.17"
FT                   /protein_id="ADU34576.1"
FT                   /translation="MKYVIGVDIGTQSTKCLLVGIDGKVHAQASVAYQPETPKPLWAQQ
FT                   DCAVWFDAVCESVRACVAKSGVAATDIAAMCVSSLYGGAGIPVDEAMQPLHPCLIWMDR
FT                   RATAEVDAVNANVDVERLQAITGNGVDSYYGYTKILWVREHLPEVWAKTRYFLPPNSYI
FT                   NRRLTGELAVDHSSAGNIGGVYDAARRTWSEEALGMLGIPARMMPPRLVESSDVVGGLS
FT                   AEWAAKLGLAEGMPLMAGGVDAAVATFCAGVTGSGDHVAMIGTSMCWGFVSPTVDARHK
FT                   LITMPHVYRGADRSYVFGGAITAGAAVTWFRETFCQAEVAEAARTGEDAHALIERKAID
FT                   VPAGAEGLVFLPYLMGERSPIWDAQAKGAFIGLSLAHSRAHLYRAVLEGVSFALQHNIE
FT                   AGRQSGQPLDDRLIVVGGAAHSDLWMQIVADITGYPVFTIEEEVEAALGAAMLAALGAG
FT                   LVDAATAERGWVTLVERARPEPAAQAVYRERFEIYKSLYPALRDAMHRLK"
     MKYVIGVDIG TQSTKCLLVG IDGKVHAQAS VAYQPETPKP LWAQQDCAVW FDAVCESVRA        60
     CVAKSGVAAT DIAAMCVSSL YGGAGIPVDE AMQPLHPCLI WMDRRATAEV DAVNANVDVE       120
     RLQAITGNGV DSYYGYTKIL WVREHLPEVW AKTRYFLPPN SYINRRLTGE LAVDHSSAGN       180
     IGGVYDAARR TWSEEALGML GIPARMMPPR LVESSDVVGG LSAEWAAKLG LAEGMPLMAG       240
     GVDAAVATFC AGVTGSGDHV AMIGTSMCWG FVSPTVDARH KLITMPHVYR GADRSYVFGG       300
     AITAGAAVTW FRETFCQAEV AEAARTGEDA HALIERKAID VPAGAEGLVF LPYLMGERSP       360
     IWDAQAKGAF IGLSLAHSRA HLYRAVLEGV SFALQHNIEA GRQSGQPLDD RLIVVGGAAH       420
     SDLWMQIVAD ITGYPVFTIE EEVEAALGAA MLAALGAGLV DAATAERGWV TLVERARPEP       480
     AAQAVYRERF EIYKSLYPAL RDAMHRLK                                          508
//

If you have problems or comments...

PBIL Back to PBIL home page