(data stored in ACNUC1104 zone)

EMBL: CP002417.PE357

CP002417.PE357       Location/Qualifiers
FT   CDS             complement(379935..380855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0358"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: vap:Vapar_0344 periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34580"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2E9"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADU34580.1"
FT                   /translation="MKNLLKTTALTAALVCAASAAQAQAPKQPLRIGMTFQELNNPYFV
FT                   TMKQALEEAAASIGATVVTTDARHDVAKQIGDVEDMIQKKVDILLLNPTDSTGVQSAVR
FT                   SAKKAGLVVVAVDANAQGPVDSFVGSKNTDAGRLACEYLAKSIGEKGDVAILDGIPVVP
FT                   ILERVKGCREALAKYPGIKVVSTQNGKQERATALTVTENILQANKDLKGIFSVNDGGSM
FT                   GALAAIDASGKDVKLASVDGAPEAIKAMQKPGSKFIATTAQYPRDQIRLAIGIALAKKW
FT                   GANVPAAVPVDVKLIDAEGAKTFTW"
     MKNLLKTTAL TAALVCAASA AQAQAPKQPL RIGMTFQELN NPYFVTMKQA LEEAAASIGA        60
     TVVTTDARHD VAKQIGDVED MIQKKVDILL LNPTDSTGVQ SAVRSAKKAG LVVVAVDANA       120
     QGPVDSFVGS KNTDAGRLAC EYLAKSIGEK GDVAILDGIP VVPILERVKG CREALAKYPG       180
     IKVVSTQNGK QERATALTVT ENILQANKDL KGIFSVNDGG SMGALAAIDA SGKDVKLASV       240
     DGAPEAIKAM QKPGSKFIAT TAQYPRDQIR LAIGIALAKK WGANVPAAVP VDVKLIDAEG       300
     AKTFTW                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page