(data stored in ACNUC1104 zone)

EMBL: CP002417.PE358

CP002417.PE358       Location/Qualifiers
FT   CDS             complement(380983..381873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0359"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: vap:Vapar_0345 transcriptional regulator, AraC
FT                   family; PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34581"
FT                   /db_xref="GOA:E6V2F0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E6V2F0"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADU34581.1"
FT                   /translation="MQPDLEIVEVRGDESFTAWAHGYPYRTVRWHFHPEYEIQLIVETK
FT                   GVYFVGDHVGHFEPGNLVLMGPDLPHNWISDVPAGQSVERRGIVIQFPAELMKNMSAAF
FT                   PEFQRIAPLLAESGSGLLFSAETALAAKPVMESLLEARGLRRVILLLSLLELLVDSHDR
FT                   QRLASPAFKPDPKAFMSHAINNVLAHISANLGDELREPMLAELVGQSPSAFSRSFRKHT
FT                   GQSFVRYVNRLRISRACELLTNSEKPVLDVCMDVGFNNVSNFNRQFLLHKRMPPTKFRN
FT                   FHRMQAAASRATNAP"
     MQPDLEIVEV RGDESFTAWA HGYPYRTVRW HFHPEYEIQL IVETKGVYFV GDHVGHFEPG        60
     NLVLMGPDLP HNWISDVPAG QSVERRGIVI QFPAELMKNM SAAFPEFQRI APLLAESGSG       120
     LLFSAETALA AKPVMESLLE ARGLRRVILL LSLLELLVDS HDRQRLASPA FKPDPKAFMS       180
     HAINNVLAHI SANLGDELRE PMLAELVGQS PSAFSRSFRK HTGQSFVRYV NRLRISRACE       240
     LLTNSEKPVL DVCMDVGFNN VSNFNRQFLL HKRMPPTKFR NFHRMQAAAS RATNAP           296
//

If you have problems or comments...

PBIL Back to PBIL home page