(data stored in ACNUC1104 zone)

EMBL: CP002417.PE364

CP002417.PE364       Location/Qualifiers
FT   CDS             complement(386412..386906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0365"
FT                   /product="poly(hydroxyalkanoate) granule-associated
FT                   protein"
FT                   /note="KEGG: vap:Vapar_0350 poly(hydroxyalkanoate)
FT                   granule-associated protein; TIGRFAM: poly(hydroxyalkanoate)
FT                   granule-associated protein; PFAM: poly granule associated
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34587"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:E6V397"
FT                   /inference="protein motif:TFAM:TIGR01837"
FT                   /protein_id="ADU34587.1"
FT                   /translation="MATQDDDSNNGNDKSSDRIKDSAQQIWLAGLGAFAKMQQEGSKAF
FT                   EALVKDGAGMQKKTQAAAEETLAQAQQRMAGFASEFGTKAAGQWGKLENIFEERVARAL
FT                   EKLGVPSAADMAALQARVEALEAQLKGSAKAAATSRKTTARKTAAPAPAAKKTLRRTKA
FT                   G"
     MATQDDDSNN GNDKSSDRIK DSAQQIWLAG LGAFAKMQQE GSKAFEALVK DGAGMQKKTQ        60
     AAAEETLAQA QQRMAGFASE FGTKAAGQWG KLENIFEERV ARALEKLGVP SAADMAALQA       120
     RVEALEAQLK GSAKAAATSR KTTARKTAAP APAAKKTLRR TKAG                        164
//

If you have problems or comments...

PBIL Back to PBIL home page