(data stored in ACNUC1104 zone)

EMBL: CP002417.PE366

CP002417.PE366       Location/Qualifiers
FT   CDS             complement(387544..388440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0367"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vap:Vapar_0352 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34589"
FT                   /db_xref="GOA:E6V399"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V399"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADU34589.1"
FT                   /translation="MSKLDLEWLAVFDEVYKTGNVSKAAERLGMAQAAASTALNKLRAH
FT                   FDDRLFTRTAQGMQPTPHAERIYPNLREVLAQLAQAQGNRSSFEPAGAQRRFRICMTDI
FT                   SEVVLLPGLLDHLRHVAPGVHIETEIISTNSGRRLQDGEVDLAVGFMPQLDAGFYQQTL
FT                   FMQNFVCLAAQNHPRIGARLARKRFEAEAHAVVSTSGTGHAIVDTTIARLGLKRDVVVR
FT                   LSSFLSVARIVAHTELLVVVPRILGKVLATQEPVKLLELPFALPDYAVKQHWHERFHAD
FT                   PGNAWLRRTLAQLFSGS"
     MSKLDLEWLA VFDEVYKTGN VSKAAERLGM AQAAASTALN KLRAHFDDRL FTRTAQGMQP        60
     TPHAERIYPN LREVLAQLAQ AQGNRSSFEP AGAQRRFRIC MTDISEVVLL PGLLDHLRHV       120
     APGVHIETEI ISTNSGRRLQ DGEVDLAVGF MPQLDAGFYQ QTLFMQNFVC LAAQNHPRIG       180
     ARLARKRFEA EAHAVVSTSG TGHAIVDTTI ARLGLKRDVV VRLSSFLSVA RIVAHTELLV       240
     VVPRILGKVL ATQEPVKLLE LPFALPDYAV KQHWHERFHA DPGNAWLRRT LAQLFSGS         298
//

If you have problems or comments...

PBIL Back to PBIL home page