(data stored in ACNUC1104 zone)

EMBL: CP002417.PE368

CP002417.PE368       Location/Qualifiers
FT   CDS             389736..390440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0369"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   vap:Vapar_0354 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34591"
FT                   /db_xref="GOA:E6V3A1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3A1"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ADU34591.1"
FT                   /translation="MSFVFTPPSIVGLPIVDSDKLFPVRRVYCVGRNYAAHAREMGFDP
FT                   DREPPFFFCKPNDDASVVPVAEGETGKIPYPPLTSNYHYEAELVVAIGKGGKDIPVDQA
FT                   SSHIHSYAVGLDMTRRDLQMKMREAGRPWEIGKAFDFSAPIAPLRTLADVGEINAGAIT
FT                   LTVDGEVRQNSDITHLIWSVNEVIANLSTLFTLQPGDLIFTGTPEGVGAVKAGQTIKVS
FT                   IERLPSLTVRID"
     MSFVFTPPSI VGLPIVDSDK LFPVRRVYCV GRNYAAHARE MGFDPDREPP FFFCKPNDDA        60
     SVVPVAEGET GKIPYPPLTS NYHYEAELVV AIGKGGKDIP VDQASSHIHS YAVGLDMTRR       120
     DLQMKMREAG RPWEIGKAFD FSAPIAPLRT LADVGEINAG AITLTVDGEV RQNSDITHLI       180
     WSVNEVIANL STLFTLQPGD LIFTGTPEGV GAVKAGQTIK VSIERLPSLT VRID             234
//

If you have problems or comments...

PBIL Back to PBIL home page