(data stored in ACNUC1104 zone)

EMBL: CP002417.PE37

CP002417.PE37        Location/Qualifiers
FT   CDS             complement(40945..41229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0037"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG:
FT                   vap:Vapar_0034 phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34260"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXR6"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /protein_id="ADU34260.1"
FT                   /translation="MFSSPTFNSIATILETDFKVDRSAISPATVLTDLGLDSLALMEFV
FT                   FAVEDAFHLRIPEDRLDPREAGITLQRLCEVIDTESSGVVAPAAEVAHA"
     MFSSPTFNSI ATILETDFKV DRSAISPATV LTDLGLDSLA LMEFVFAVED AFHLRIPEDR        60
     LDPREAGITL QRLCEVIDTE SSGVVAPAAE VAHA                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page