(data stored in ACNUC1104 zone)

EMBL: CP002417.PE373

CP002417.PE373       Location/Qualifiers
FT   CDS             395419..396036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0374"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A4715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34596"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3A6"
FT                   /inference="similar to AA sequence:KEGG:Bcep18194_A4715"
FT                   /protein_id="ADU34596.1"
FT                   /translation="MQWGCASTPEGEPVHGKDEVVSFLAAKDGRKVVVAAEKYHYVFDG
FT                   DPSVAALLRWSGRTKVTPSLNGELKVARNNSFEGSYTLVAFDADLTPEDRTFLIQTGFA
FT                   KTDMKYGDRTGPALRYFGTVYGTRYAAAPLKPADTLDFSRSFLIRYVEQETATGPAAQP
FT                   APSPLIYDDGGKLLVGGVPMFIVQGGTDYRCRARFMDICFYK"
     MQWGCASTPE GEPVHGKDEV VSFLAAKDGR KVVVAAEKYH YVFDGDPSVA ALLRWSGRTK        60
     VTPSLNGELK VARNNSFEGS YTLVAFDADL TPEDRTFLIQ TGFAKTDMKY GDRTGPALRY       120
     FGTVYGTRYA AAPLKPADTL DFSRSFLIRY VEQETATGPA AQPAPSPLIY DDGGKLLVGG       180
     VPMFIVQGGT DYRCRARFMD ICFYK                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page