(data stored in SCRATCH zone)

EMBL: CP002417.PE374

CP002417.PE374       Location/Qualifiers
FT   CDS             396177..397055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0375"
FT                   /product="Choloyl-CoA hydrolase"
FT                   /EC_number="3.1.2.27"
FT                   /note="KEGG: vap:Vapar_0359 choloyl-CoA hydrolase; PFAM:
FT                   acyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34597"
FT                   /db_xref="GOA:E6V3A7"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3A7"
FT                   /inference="protein motif:PRIAM:3.1.2.27"
FT                   /protein_id="ADU34597.1"
FT                   /translation="MTTDPATAARLVDELVALMQLEPLGGDRFRAQSEDIGTPAVFGGQ
FT                   VLGQSLAAASLTVGADRPVHSMHAYFLLPGEHAPIKYSVDRVRDGRSFTTRHVVARQGE
FT                   RIIFEMSASFQTVDDGVEHQLAMPAVEGPEGLVSELDQRLALGDRLPERWRIKGLEPHG
FT                   IEYRRVEADDLLTPIVRPSESAIWMRAIAPLPDDPVVHRALLAYASDHGLLRAAMLPHG
FT                   LSFMSGQVRPASLDHAMWFHRDFRMDDWLLYVLDSPSASGARGLCRGSLFTRDGRLVAS
FT                   TAQEGMLRIVR"
     MTTDPATAAR LVDELVALMQ LEPLGGDRFR AQSEDIGTPA VFGGQVLGQS LAAASLTVGA        60
     DRPVHSMHAY FLLPGEHAPI KYSVDRVRDG RSFTTRHVVA RQGERIIFEM SASFQTVDDG       120
     VEHQLAMPAV EGPEGLVSEL DQRLALGDRL PERWRIKGLE PHGIEYRRVE ADDLLTPIVR       180
     PSESAIWMRA IAPLPDDPVV HRALLAYASD HGLLRAAMLP HGLSFMSGQV RPASLDHAMW       240
     FHRDFRMDDW LLYVLDSPSA SGARGLCRGS LFTRDGRLVA STAQEGMLRI VR               292
//

If you have problems or comments...

PBIL Back to PBIL home page