(data stored in SCRATCH zone)

EMBL: CP002417.PE375

CP002417.PE375       Location/Qualifiers
FT   CDS             397088..397699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0376"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bpt:Bpet4536 putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34598"
FT                   /db_xref="GOA:E6V3A8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3A8"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ADU34598.1"
FT                   /translation="MKIFHSPASPFVRKCMVVAHELGIADRIEKLPSAAGPVKRDATIL
FT                   PKNPLGQVPTFLCDDGQVLYDSRVICEYLDAKHSGSLFPADGTQRWARLTELALADGMT
FT                   AAALLARYETMLRPEALRWNDWTEGQLAKVRTGLEWLETAAPSFGDRVDIGTIAFGCTL
FT                   GYMDFRFPSVDWRGEAPNTAKWFEVFNQRASMQATLPAVA"
     MKIFHSPASP FVRKCMVVAH ELGIADRIEK LPSAAGPVKR DATILPKNPL GQVPTFLCDD        60
     GQVLYDSRVI CEYLDAKHSG SLFPADGTQR WARLTELALA DGMTAAALLA RYETMLRPEA       120
     LRWNDWTEGQ LAKVRTGLEW LETAAPSFGD RVDIGTIAFG CTLGYMDFRF PSVDWRGEAP       180
     NTAKWFEVFN QRASMQATLP AVA                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page