(data stored in ACNUC1104 zone)

EMBL: CP002417.PE376

CP002417.PE376       Location/Qualifiers
FT   CDS             397980..399056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0377"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: pol:Bpro_2845 transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34599"
FT                   /db_xref="GOA:E6V3A9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3A9"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADU34599.1"
FT                   /translation="MNEITRVGVDLAKRVIQVFAVNAAGLRVTGRALARDKFLAWCAQL
FT                   PAGCLVAMEASSSAHYWARKLLALGLDARIIAAPHVVPYRLQGKSGKNDANDAAAICEA
FT                   ASRPHMHFVPIKSVEQQSMLCIHRLREGVKADRTACINRIRGLLAEFGLVFAQSPEALR
FT                   QVLPDAMEDASNELGALARLTLQRAYAQWQELDAHLRWCDERIAAHGKASDQVRQAEQL
FT                   LGVGPVTASAVVATVGDFKQFKNGAQFGAWLGLTPRQNSSGGKNNLGRITKRGDAYLRT
FT                   LLIQGAKSIVLTAHRRDDPISRWVQALRERSGWQKAVVALANKNARILWAVFARGRAFD
FT                   AHHVSTKPPGAIAAVIAV"
     MNEITRVGVD LAKRVIQVFA VNAAGLRVTG RALARDKFLA WCAQLPAGCL VAMEASSSAH        60
     YWARKLLALG LDARIIAAPH VVPYRLQGKS GKNDANDAAA ICEAASRPHM HFVPIKSVEQ       120
     QSMLCIHRLR EGVKADRTAC INRIRGLLAE FGLVFAQSPE ALRQVLPDAM EDASNELGAL       180
     ARLTLQRAYA QWQELDAHLR WCDERIAAHG KASDQVRQAE QLLGVGPVTA SAVVATVGDF       240
     KQFKNGAQFG AWLGLTPRQN SSGGKNNLGR ITKRGDAYLR TLLIQGAKSI VLTAHRRDDP       300
     ISRWVQALRE RSGWQKAVVA LANKNARILW AVFARGRAFD AHHVSTKPPG AIAAVIAV         358
//

If you have problems or comments...

PBIL Back to PBIL home page