(data stored in ACNUC1104 zone)

EMBL: CP002417.PE377

CP002417.PE377       Location/Qualifiers
FT   CDS             399505..400218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0378"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   vap:Vapar_0360 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34600"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADU34600.1"
FT                   /translation="MSSEAQKKVAVVTAGGSGMGAAAARKLAEDGFRVAILSSSGKGEA
FT                   LAQELGGIGVTGSNQSNDDIKRLVDKVTDTWGRVDVLVNSAGHGPRAPILEISDEDWHR
FT                   GMDVYLLSAVRPSRLVAPLMVKQGGGSIINISTFAAFEPDPVFPTSGVFRAGLAAFTKL
FT                   FADQYAAHNVRMNNVLPGFIDSLPEKEVFRERIPMGRYGKSSEIAATIGFLASEGAGYI
FT                   TGQNLRVDGGITRSV"
     MSSEAQKKVA VVTAGGSGMG AAAARKLAED GFRVAILSSS GKGEALAQEL GGIGVTGSNQ        60
     SNDDIKRLVD KVTDTWGRVD VLVNSAGHGP RAPILEISDE DWHRGMDVYL LSAVRPSRLV       120
     APLMVKQGGG SIINISTFAA FEPDPVFPTS GVFRAGLAAF TKLFADQYAA HNVRMNNVLP       180
     GFIDSLPEKE VFRERIPMGR YGKSSEIAAT IGFLASEGAG YITGQNLRVD GGITRSV          237
//

If you have problems or comments...

PBIL Back to PBIL home page