(data stored in ACNUC1104 zone)

EMBL: CP002417.PE382

CP002417.PE382       Location/Qualifiers
FT   CDS             complement(404125..405087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0383"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vap:Vapar_0364 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34605"
FT                   /db_xref="GOA:E6V3B5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B5"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34605.1"
FT                   /translation="MKLSSRSIGLGLVFLLLAAFPLIAPLFGLDFYIGFVRRVLIVALA
FT                   AASLNFILGFGGMVALGHAGFIGMGAYTVVALSDAGVMSAWVMWPLAALVAGLVAALIG
FT                   TVALRTRGVYFIMTTLAFAQMLYFVVVSLRRYGGDDGYTLMSRPTLLPGLDLGNESNFY
FT                   WVVLVIVALALWWLHRATQSRFGHALMGIRDNETRMRALGYPVFRLQLVAFAIAGAIAG
FT                   LAGALLAGGNGFVSPATMHWTQSATLLVMVVIGGLGRSWGGPVGAIVWLLLEEFLKQHT
FT                   EHWHMPLGLLLIAVALWAPKGLAALARRRQAAPLTKATP"
     MKLSSRSIGL GLVFLLLAAF PLIAPLFGLD FYIGFVRRVL IVALAAASLN FILGFGGMVA        60
     LGHAGFIGMG AYTVVALSDA GVMSAWVMWP LAALVAGLVA ALIGTVALRT RGVYFIMTTL       120
     AFAQMLYFVV VSLRRYGGDD GYTLMSRPTL LPGLDLGNES NFYWVVLVIV ALALWWLHRA       180
     TQSRFGHALM GIRDNETRMR ALGYPVFRLQ LVAFAIAGAI AGLAGALLAG GNGFVSPATM       240
     HWTQSATLLV MVVIGGLGRS WGGPVGAIVW LLLEEFLKQH TEHWHMPLGL LLIAVALWAP       300
     KGLAALARRR QAAPLTKATP                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page