(data stored in ACNUC1104 zone)

EMBL: CP002417.PE383

CP002417.PE383       Location/Qualifiers
FT   CDS             complement(405084..406004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0384"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vap:Vapar_0365 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34606"
FT                   /db_xref="GOA:E6V3B6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B6"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34606.1"
FT                   /translation="MSGILVLEQLLNGLGYGLMLFLLAAGLTLVFGIMDVLNLAHGSLF
FT                   MSGAYVAAEAHTRTGSFTAAIVIAVAVTVVVALLLEVLLMRRLYTRDHLAQVLATFGVI
FT                   LVADDIVKMAWGPSPVMSPTPAALSGPVNLMDGLPYPAYRLVILIGGLLVALALYLLVN
FT                   HTRIGMRVRAGASDRPMAELMGVRVGRIFNGVFLLGAALAALAGALMGPIVAVQVGMGE
FT                   AILIPALVVLVIGGIGSVRGAFVAALLVGVVDTIGRAFVPMLLRATLPPATAADLGPLF
FT                   AEVAMYALMVIVLIFRPSGLFSART"
     MSGILVLEQL LNGLGYGLML FLLAAGLTLV FGIMDVLNLA HGSLFMSGAY VAAEAHTRTG        60
     SFTAAIVIAV AVTVVVALLL EVLLMRRLYT RDHLAQVLAT FGVILVADDI VKMAWGPSPV       120
     MSPTPAALSG PVNLMDGLPY PAYRLVILIG GLLVALALYL LVNHTRIGMR VRAGASDRPM       180
     AELMGVRVGR IFNGVFLLGA ALAALAGALM GPIVAVQVGM GEAILIPALV VLVIGGIGSV       240
     RGAFVAALLV GVVDTIGRAF VPMLLRATLP PATAADLGPL FAEVAMYALM VIVLIFRPSG       300
     LFSART                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page