(data stored in ACNUC1104 zone)

EMBL: CP002417.PE384

CP002417.PE384       Location/Qualifiers
FT   CDS             complement(406134..407339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0385"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   vap:Vapar_0366 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34607"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B7"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADU34607.1"
FT                   /translation="MSHLSPKSPALPRTLVSLLLCGAALGTAASAMAAPVKVGLALDIS
FT                   GPFAALGAEARDGFALGIKQLNGKLGGQDVEFVQADMAGSPDQAKQLVDRMIQRDKIDI
FT                   FSGPIGSNVALAVGPTLFNAKVPYLSANAGPSQFAGAQCNAYFFGTAYQNDQFHEAAGK
FT                   FAQDRGFKKTVLIAPNYPAGKDALGGFKRQFKGQVADELYTKLGQIDYAAELAQLRAAK
FT                   PDSIYFFLPGAMGINFIKQFVGAGLSKDITLVTSGFSADEDVIGAVGEPMLGLFNTSHW
FT                   AHDLDNPANKAFVAAFRKEYNGRYPSVYAAQAYDAILAMDAAVKQSGGNAQNREAVVAA
FT                   LKKANYASTRGAFKYANNHYPIENFYLRVIGKDAQGKVTNKLINTVLTNYGDSYADKCP
FT                   LK"
     MSHLSPKSPA LPRTLVSLLL CGAALGTAAS AMAAPVKVGL ALDISGPFAA LGAEARDGFA        60
     LGIKQLNGKL GGQDVEFVQA DMAGSPDQAK QLVDRMIQRD KIDIFSGPIG SNVALAVGPT       120
     LFNAKVPYLS ANAGPSQFAG AQCNAYFFGT AYQNDQFHEA AGKFAQDRGF KKTVLIAPNY       180
     PAGKDALGGF KRQFKGQVAD ELYTKLGQID YAAELAQLRA AKPDSIYFFL PGAMGINFIK       240
     QFVGAGLSKD ITLVTSGFSA DEDVIGAVGE PMLGLFNTSH WAHDLDNPAN KAFVAAFRKE       300
     YNGRYPSVYA AQAYDAILAM DAAVKQSGGN AQNREAVVAA LKKANYASTR GAFKYANNHY       360
     PIENFYLRVI GKDAQGKVTN KLINTVLTNY GDSYADKCPL K                           401
//

If you have problems or comments...

PBIL Back to PBIL home page