(data stored in SCRATCH zone)

EMBL: CP002417.PE386

CP002417.PE386       Location/Qualifiers
FT   CDS             complement(407917..412626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0387"
FT                   /product="Ricin B lectin"
FT                   /note="KEGG: vap:Vapar_0368 ricin B lectin; PFAM: Ricin B
FT                   lectin; PKD domain containing protein; Laminin G sub domain
FT                   2; SMART: Ricin B lectin; PKD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34609"
FT                   /db_xref="GOA:E6V3B9"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3B9"
FT                   /inference="protein motif:PFAM:PF00652"
FT                   /protein_id="ADU34609.1"
FT                   /translation="MKIRYYVMALMVPFVTLLTHAAITGVSPMTTLSNMATAVSEAVAD
FT                   PLPLQGPGLGNLTYTSAELFKPVSMITSPNHPLDPAHSSAYESREVPATYAGRKDYGMN
FT                   AGIMVNGYFLTSFAPDSGLGPGGFLLYDVSNPRQIQLVKKIYEPEARTKEFRETHSFGT
FT                   AKIGGKTYVVLPSINGVEFWDFTDINDIKQVKKLALPGVNSGDYENVAWQLWWQAPYLY
FT                   VASAGRGMFIVDARDPANAVVANRGAGKPNPVPTGELGGFRLGPIFTMGNHMVLTAMES
FT                   NGGFASLDISDPLNPKVLDSIVGTTPFYYATCFDGRNLHVSTRNSGAKMYSYDLSDRSR
FT                   FVAEDNRLVIDEQLYCATQDNYVIQGAQTRIHKVDVSNPLNHVEVGRGSILREDDPNFS
FT                   HSDNGQVAIFGNLVFVGNDHGSGSGFVVHAVDPDIVKPEVKQVSPANGAKQQALTSRIG
FT                   LGMTDNIRPESVNSNTFIVRPVGGNTLAGTYSVQLGIVNFHPEQPLQPGTSYEVFLPAN
FT                   GLKDYAGNAIGADYRSTFNTGNATDINLMHYWTLAGNLSDQIGNNSGTPASGDAFESIG
FT                   MNFANRTAGVPLKNDGVATVLGGTASLSFYMKTTQAGGANSWTAPGIFGRDQPSGADDV
FT                   FWGWLDSNGRIKLSVGNDGGTASTAAVNDGNWHHVVLTRDAASGAQAVYVDGVKTTSAG
FT                   LTGTKGLANKFSVLGQIQGNTALFKGTLAEVRVYGRVLSDTEVNTLRGQAIIGDPGIGG
FT                   GPKLVNGQLVFNPGTLGSSGAQFRWNFGDGTQTAYSNQPNYTYTYTRPGHFTVTLTVKD
FT                   ANGRETFYTYNLTVIVPTTARAPTHTTNIAGDANSVYSVNPDSGTVAAINSETLAKRWE
FT                   VRVGDEAKTLAVGPDGRIWVTVQGEDKLVALNAADGSVSATVPLAYGSGPYGVAFTPDG
FT                   AKGLLTLESKSVLMSFDPSNGATTGAVALEGNLRGIAVSGDAQVAYVTRFKSKMTGGQL
FT                   HKVNLQSMSAMPTIALPVDTTTVDTESRARGVANYLSQVIISPDGTRAVLPSKKDNIVR
FT                   GKFRDGINLSHDQTVRSILSQVNLQTAAEVFAEQIDFDDRAPARAALYSPSGDYLFVAQ
FT                   MEGNRVAIVDPYSRSVRGEINASSAPHGLYLDAARKRLFVNNFLARSVSVHDVASVLAS
FT                   ETAAPVFLQNVSTVAQEPMAAAALRGKQVFYNASDRRMSKDNYISCASCHADAGDDGMV
FT                   WDFTQRGEGLRRTISLMGRRGLGHGKLHWTANFDEVQDFENDIRNEFGGTGFLSNADFT
FT                   ATQDPLGAPKAGKNAQLDDLAAYLTSLNKYMRSPARNADGSLSVDAARGQALFASAQCV
FT                   TCHTGATFRDGQRHDVGTIQLSSGKGMNQPLAGVGFDTPTLLGTWNTTAFFHNGQAATL
FT                   QDVLAGGHGNASSLPPADVVAIREYVRSQDSDPTPTITRIRSNLSNLCVNIKGVSTTSG
FT                   ATAVQWPCGTASNEKFTVTSLTGGYVQFKAEHSGLCLAQSGTATTNAAVVQLACSAGDT
FT                   TQWSLVGGTIKNRASGSCLDVPNASTAQDTALITWTCNGGTNQSWTQLP"
     MKIRYYVMAL MVPFVTLLTH AAITGVSPMT TLSNMATAVS EAVADPLPLQ GPGLGNLTYT        60
     SAELFKPVSM ITSPNHPLDP AHSSAYESRE VPATYAGRKD YGMNAGIMVN GYFLTSFAPD       120
     SGLGPGGFLL YDVSNPRQIQ LVKKIYEPEA RTKEFRETHS FGTAKIGGKT YVVLPSINGV       180
     EFWDFTDIND IKQVKKLALP GVNSGDYENV AWQLWWQAPY LYVASAGRGM FIVDARDPAN       240
     AVVANRGAGK PNPVPTGELG GFRLGPIFTM GNHMVLTAME SNGGFASLDI SDPLNPKVLD       300
     SIVGTTPFYY ATCFDGRNLH VSTRNSGAKM YSYDLSDRSR FVAEDNRLVI DEQLYCATQD       360
     NYVIQGAQTR IHKVDVSNPL NHVEVGRGSI LREDDPNFSH SDNGQVAIFG NLVFVGNDHG       420
     SGSGFVVHAV DPDIVKPEVK QVSPANGAKQ QALTSRIGLG MTDNIRPESV NSNTFIVRPV       480
     GGNTLAGTYS VQLGIVNFHP EQPLQPGTSY EVFLPANGLK DYAGNAIGAD YRSTFNTGNA       540
     TDINLMHYWT LAGNLSDQIG NNSGTPASGD AFESIGMNFA NRTAGVPLKN DGVATVLGGT       600
     ASLSFYMKTT QAGGANSWTA PGIFGRDQPS GADDVFWGWL DSNGRIKLSV GNDGGTASTA       660
     AVNDGNWHHV VLTRDAASGA QAVYVDGVKT TSAGLTGTKG LANKFSVLGQ IQGNTALFKG       720
     TLAEVRVYGR VLSDTEVNTL RGQAIIGDPG IGGGPKLVNG QLVFNPGTLG SSGAQFRWNF       780
     GDGTQTAYSN QPNYTYTYTR PGHFTVTLTV KDANGRETFY TYNLTVIVPT TARAPTHTTN       840
     IAGDANSVYS VNPDSGTVAA INSETLAKRW EVRVGDEAKT LAVGPDGRIW VTVQGEDKLV       900
     ALNAADGSVS ATVPLAYGSG PYGVAFTPDG AKGLLTLESK SVLMSFDPSN GATTGAVALE       960
     GNLRGIAVSG DAQVAYVTRF KSKMTGGQLH KVNLQSMSAM PTIALPVDTT TVDTESRARG      1020
     VANYLSQVII SPDGTRAVLP SKKDNIVRGK FRDGINLSHD QTVRSILSQV NLQTAAEVFA      1080
     EQIDFDDRAP ARAALYSPSG DYLFVAQMEG NRVAIVDPYS RSVRGEINAS SAPHGLYLDA      1140
     ARKRLFVNNF LARSVSVHDV ASVLASETAA PVFLQNVSTV AQEPMAAAAL RGKQVFYNAS      1200
     DRRMSKDNYI SCASCHADAG DDGMVWDFTQ RGEGLRRTIS LMGRRGLGHG KLHWTANFDE      1260
     VQDFENDIRN EFGGTGFLSN ADFTATQDPL GAPKAGKNAQ LDDLAAYLTS LNKYMRSPAR      1320
     NADGSLSVDA ARGQALFASA QCVTCHTGAT FRDGQRHDVG TIQLSSGKGM NQPLAGVGFD      1380
     TPTLLGTWNT TAFFHNGQAA TLQDVLAGGH GNASSLPPAD VVAIREYVRS QDSDPTPTIT      1440
     RIRSNLSNLC VNIKGVSTTS GATAVQWPCG TASNEKFTVT SLTGGYVQFK AEHSGLCLAQ      1500
     SGTATTNAAV VQLACSAGDT TQWSLVGGTI KNRASGSCLD VPNASTAQDT ALITWTCNGG      1560
     TNQSWTQLP                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page