(data stored in SCRATCH zone)

EMBL: CP002417.PE387

CP002417.PE387       Location/Qualifiers
FT   CDS             complement(412855..413715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0388"
FT                   /product="deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; KEGG:
FT                   vap:Vapar_0369 deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34610"
FT                   /db_xref="GOA:E6V3C0"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C0"
FT                   /inference="protein motif:PFAM:PF01791"
FT                   /protein_id="ADU34610.1"
FT                   /translation="MSKDKTARLNRLLTNGRCLDIALDHGVCNEPSFLDGLEDMPQVID
FT                   KLVAAGPDALQLNYGQSDLLQDRPGRDKPALVMRIDMGNPYNATLHRVMWAQLQNEHDP
FT                   VLPAVQRDAACVVVNLFMLPNEPDLFRQCVQNIARVRADCDRYGMPLMIEPLVMQSPTP
FT                   GSRYMVDGDAEKIVTLVRLAREMGADIVKADPTSDPKDFHRVVQAARCPVLVRGGGRED
FT                   LSQVFARSRTLLDQGAVGMVYGRNVYQHGNPSAVVSALMAMIHRDASAEAALDIYESGG
FT                   TKQGK"
     MSKDKTARLN RLLTNGRCLD IALDHGVCNE PSFLDGLEDM PQVIDKLVAA GPDALQLNYG        60
     QSDLLQDRPG RDKPALVMRI DMGNPYNATL HRVMWAQLQN EHDPVLPAVQ RDAACVVVNL       120
     FMLPNEPDLF RQCVQNIARV RADCDRYGMP LMIEPLVMQS PTPGSRYMVD GDAEKIVTLV       180
     RLAREMGADI VKADPTSDPK DFHRVVQAAR CPVLVRGGGR EDLSQVFARS RTLLDQGAVG       240
     MVYGRNVYQH GNPSAVVSAL MAMIHRDASA EAALDIYESG GTKQGK                      286
//

If you have problems or comments...

PBIL Back to PBIL home page