(data stored in SCRATCH zone)

EMBL: CP002417.PE388

CP002417.PE388       Location/Qualifiers
FT   CDS             complement(413759..414751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0389"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: vap:Vapar_0370
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34611"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C1"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADU34611.1"
FT                   /translation="MKSEMKKTTLGPSGIECSAIGLGTWAMGGWMWGGGDNAAAVIAIQ
FT                   ASLDAGVNLIDTAPAYGLGRSESIVGTALKGRRQEAVIATKCGLVWHTQQGTHFFEEDG
FT                   HPVYRFLGRESIFHECEESLKRLQTDYIDLYITHWQDSTTPVAETMDALLDLKKQGKIR
FT                   AIGVSNVNPETLAEYLRYGPVDAAQERYSLIDREIETTLAPLCSEHNVAVLGYSSLALG
FT                   LLAGPIDPEREFKGDDQRASNPRFSAANRATLKAFFEELEPIRAKLGCSFGQMMIAWTV
FT                   ARGTVAVALCGARVRQQAIENAGAGAVELGDEALRLIDAAAKRHLSALA"
     MKSEMKKTTL GPSGIECSAI GLGTWAMGGW MWGGGDNAAA VIAIQASLDA GVNLIDTAPA        60
     YGLGRSESIV GTALKGRRQE AVIATKCGLV WHTQQGTHFF EEDGHPVYRF LGRESIFHEC       120
     EESLKRLQTD YIDLYITHWQ DSTTPVAETM DALLDLKKQG KIRAIGVSNV NPETLAEYLR       180
     YGPVDAAQER YSLIDREIET TLAPLCSEHN VAVLGYSSLA LGLLAGPIDP EREFKGDDQR       240
     ASNPRFSAAN RATLKAFFEE LEPIRAKLGC SFGQMMIAWT VARGTVAVAL CGARVRQQAI       300
     ENAGAGAVEL GDEALRLIDA AAKRHLSALA                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page