(data stored in ACNUC1104 zone)

EMBL: CP002417.PE389

CP002417.PE389       Location/Qualifiers
FT   CDS             complement(414748..415704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0390"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vap:Vapar_0371 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34612"
FT                   /db_xref="GOA:E6V3C2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3C2"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADU34612.1"
FT                   /translation="MKPANKLTSMREAGLLLIIAVLCIAMSFASPYFLTWDNVRAMLLS
FT                   FSIEGIVVVGMTILLIVGGIDLSVGSVVCFAMVVTGKLFLMGVDPWLASLVAIGMCGLI
FT                   GAMIGGCVTRIGLNHFIASLAFMVIVRGLCLALTQGTPQSLFSLPAEFKFIGQGTLFGV
FT                   PAVILIFLAIVVVSDFVLRRSTLLRRVFYTGSNEKAALYSGIRVGRVKFWVTVLCSASA
FT                   GLAGVIYTARFGAATPTFGMGMELNVIAAAVIGGASLKGGSGTVLGAVLGLALLSVVTS
FT                   SLILLDVSPYWQDVIKGLILLAAVTIDHIMNTRKKTR"
     MKPANKLTSM REAGLLLIIA VLCIAMSFAS PYFLTWDNVR AMLLSFSIEG IVVVGMTILL        60
     IVGGIDLSVG SVVCFAMVVT GKLFLMGVDP WLASLVAIGM CGLIGAMIGG CVTRIGLNHF       120
     IASLAFMVIV RGLCLALTQG TPQSLFSLPA EFKFIGQGTL FGVPAVILIF LAIVVVSDFV       180
     LRRSTLLRRV FYTGSNEKAA LYSGIRVGRV KFWVTVLCSA SAGLAGVIYT ARFGAATPTF       240
     GMGMELNVIA AAVIGGASLK GGSGTVLGAV LGLALLSVVT SSLILLDVSP YWQDVIKGLI       300
     LLAAVTIDHI MNTRKKTR                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page